PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10023006m
Common NameCARUB_v10023006mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 523aa    MW: 57758.4 Da    PI: 7.6551
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10023006mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1048.1e-33182239260
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      +DgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  +++++ei+Y+g+Hnh+k
  Carubv10023006m 182 EDGYNWRKYGQKQVKGSENPRSYYKCTFPSCPTKKKVERSL-EGQITEIVYKGSHNHPK 239
                      7****************************************.***************85 PP

2WRKY1054e-33360418159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+++d ++v++tYeg+Hnh+
  Carubv10023006m 360 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTIGCPVRKHVERASHDMRAVITTYEGKHNHD 418
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.6E-27170240IPR003657WRKY domain
SuperFamilySSF1182903.01E-24181240IPR003657WRKY domain
SMARTSM007741.0E-33181239IPR003657WRKY domain
PROSITE profilePS5081122.905182240IPR003657WRKY domain
PfamPF031067.9E-25182238IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.5E-37345420IPR003657WRKY domain
SuperFamilySSF1182903.27E-29352420IPR003657WRKY domain
PROSITE profilePS5081138.434355420IPR003657WRKY domain
SMARTSM007741.8E-38360419IPR003657WRKY domain
PfamPF031062.0E-25361418IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MAASSLLTMD NSRTRQNMNG SAAATNWSQQ NGRTSTSSLE DLEIPKFRSF APSSISISPS  60
LVSPSTCFSP SVFLDSPAFV SSSAHVLASP TTGALITNES NTKLINEGEK KDNNINFFDF  120
SFQTQSSGVS APTTTTTTTN NSSIFQSQEQ QRKNQSDQWS QNESRQNNQA VSYNGREQRK  180
GEDGYNWRKY GQKQVKGSEN PRSYYKCTFP SCPTKKKVER SLEGQITEIV YKGSHNHPKP  240
QSTRRSSSSS SSTFHSAVYN ASLDHHRQAS SDQPNSNNSF HHSDSFAMQQ DDNTTSDSVG  300
DDEFEQGSSI VSRDEEDCGS EPEAKRWKGE NETNGGNGGV SKTVREPRIV VQTTSDIDIL  360
DDGYRWRKYG QKVVKGNPNP RSYYKCTTIG CPVRKHVERA SHDMRAVITT YEGKHNHDVP  420
AARGSGYATN RAPQDASSVP IRPAAIAGHS NYTTSSQAPY TLQMLHNNNN NTNARSFGYA  480
MNNNNNNNNN NLQTLQNFVG DGFSRAKEEP NEETSFFDSF MP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-38182421878Probable WRKY transcription factor 4
2lex_A6e-38182421878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3149710.0AY314971.1 Capsella rubella WRKY transcription factor 33 (WRKY33) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006293466.10.0hypothetical protein CARUB_v10023006mg
SwissprotQ8S8P50.0WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLR0HAD40.0R0HAD4_9BRAS; Uncharacterized protein
STRINGAT2G38470.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45832755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.10.0WRKY DNA-binding protein 33